New special offers are available!

SARS-CoV-2 Proteins and Kits

In December of 2019, the SARS-CoV-2 virus, which causes the disease COVID-19, was first detected in Wuhan, China. The SARS-CoV-2 virus is a single-stranded RNA coronavirus that causes respiratory infections. The rapid spread of COVID-19 has resulted in a global pandemic which has caused an unprecedented social and economic disruption to daily life.

To aid in the advancement of infectious disease research, Advansta now offers recombinant forms of the Nucleocapsid and Spike Receptor Binding Domain (RBD) proteins encoded by the virus as well as ELISA kits to detect the IgG immune response to both the Nucleocapsid and Spike (RBD) proteins. Each protein is expressed in Escherichia coli or CHO K1 cells and affinity purified. The ELISA assays are designed for the qualitative measurement of human IgG, immunoglobulin that is produced in response to an antigen, against the Nucleocapsid or Spike (RBD) proteins from the SARS-CoV-2 virus. Each ELISA kit contains a high binding ELISA plate, a recombinant SARS-CoV-2 protein, Positive and Negative Control Serum, 1X EIA Coating Buffer, AdvanBlock-EIA, Anti-Human IgG HRP Conjugate, TMB Substrate and Stop Solution sufficient to perform one 96-well colorimetric ELISA assay.

SARS-CoV-2 Proteins and Kits


CAT # PRODUCT SIZE PRICE QUANTITY
K-16026-001 SARS-CoV-2 IgG ELISA Kit, Nucleocapsid 1 kit $ 650.00
(USD)
Add to cart
K-16027-001 SARS-CoV-2 IgG ELISA Kit, Spike (RBD) 1 kit $ 669.00
(USD)
Add to cart
R-03150-U10 SARS-CoV-2 Spike (RBD), C-Tag (CHO-K1) 100 ug $ 620.00
(USD)
Add to cart
R-03151-U10 SARS-CoV-2 Spike (RBD), His-Tag (CHO-K1) 100 ug $ 620.00
(USD)
Add to cart
R-03152-U10 SARS-CoV-2 Nucleocapsid, His-Tag (E.coli) 100 ug $ 596.00
(USD)
Add to cart

Description

 

SARS-CoV-2 ELISA Kits contain everything you need to conveniently measure the lgG immune response against the SARS-CoV-2 Nucleocapsid or Spike (RBD) proteins in COVID-19 positive or immunized patients.

SARS-CoV-2 figure 3

Figure 1. Evaluation of lgG humoral immune response by ELISA to recombinant SARS-CoV-2 target proteins in negative and COVID-19 positive serum samples.

For all your other research needs we offer purified Nucleocapsid and Spike (RBD) recombinant proteins.

SARS-CoV-2 figure 3

Figure 2. SDS-Page analysis of the purified recombinant SARS-CoV-2 target proteins.

SARS-CoV-2 figure 3

Figure 3. A humoral lgG immune response against recombinant nucleocapsid protein was detected by Western blot. Negative and COVID-19 positive serum samples diluted 1:2500 in AdvanBlock-Chemi were incubated with blotted nitrocellulose membranes for one hour. The blots were then incubated with a goat anti-human IgG HRP conjugate and antibodies against the nucleocapsid 

Recombinant SARS-CoV-2 Protein Sequences

R-03150-U10 (Expressed in E.coli) Sequence Nucleocapsid (M1-A419) with C-terminal 6XHis tag:
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVP
INTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTR
NPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLL
DRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTD
YKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKK
KADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQAGSHHHHHHHH
 
R-03151-U10 (Expressed in CHO-K1) Sequence Spike (RBD) (R319-F541) with C-terminal 6XHis tag:
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVY
ADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQ
AGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFHHHHHH
 
R-03152-U10 (Expressed in CHO-K1) Sequence Spike (RBD) (R319-F541) with C-terminal C tag:
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVY
ADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQ
AGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGGGSEPEA